Proteintech, 86960-1-RR, JAM3 Recombinant monoclonal antibody

Size: 20ul / 100ul The JAM3 (86960-1-RR) by Proteintech is a Recombinant antibody targeting JAM3 in WB, IF/ICC, ELISA applications with reactivity to human, mouse samples 86960-1-RR targets JAM3 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: SH-SY5Y cells, SK-N-SH cells, A375 cells, Jurkat cells, HEK-293 cells, human heart tissue, mouse heart tissue Positive IF/ICC detected in: U-251 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Junctional adhesion molecule 3 (JAM3) is a type I transmembrane glycoprotein containing two Ig-like domains, which is expressed in various tissues and plays a crucial role in cell junctions, cell polarity, and motility (PMID: 34292449; 28931565). It has been proposed that JAM3 participates in leukocyte-platelet interactions, as well as angiogenesis and brain development (PMID: 12208882; 23255084). JAM3 may also be a new marker for predicting the prognosis and immune functions of bladder cancer patients (PMID: 38400838). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg6611 Product name: Recombinant Human JAM3 protein (rFc Tag) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 32-241 aa of NM_032801.5 Sequence: VNLKSSNRTPVVQEFESVELSCIITDSQTSDPRIEWKKIQDEQTTYVFFDNKIQGDLAGRAEILGKTSLKIWNVTRRDSALYRCEVVARNDRKEIDEIVIELTVQVKPVTPVCRVPKAVPVGKMATLHCQESEGHPRPHYSWYRNDVPLPTDSRANPRFRNSSFHLNSETGTLVFTAVHKDDSGQYYCIASNDAGSARCEEQEMEVYDLN Predict reactive species Full Name: junctional adhesion molecule 3 Calculated Molecular Weight: 35 kDa Observed Molecular Weight: 40 kDa GenBank Accession Number: NM_032801.5 Gene Symbol: JAM3 Gene ID (NCBI): 83700 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9BX67-1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.