Proteintech, 98005-1-RR, Anti-Mouse IL-17A Rabbit Recombinant Antibody

Size: 100ug The IL-17A (98005-1-RR) by Proteintech is a Recombinant antibody targeting IL-17A in FC (Intra) applications with reactivity to mouse samples 98005-1-RR targets IL-17A in FC (Intra) applications and shows reactivity with mouse samples. Tested Applications Positive FC (Intra) detected in: PMA and ionomycin stimulated Th17-polarized splenocytes Recommended dilution Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in 100 μl suspension Background Information IL-17A, also named as IL-17, is a proinflammatory cytokine. IL-17, synthesized only by memory T cells and natural killer cells, has pleiotropic effects, mainly in the recruitment and activation of neutrophils. This cytokine regulates the activities of NF-kappaB and mitogen-activated protein kinases. This cytokine can stimulate the expression of IL6 and cyclooxygenase-2 (PTGS2/COX-2), as well as enhance the production of nitric oxide (NO). High levels of this cytokine are associated with several chronic inflammatory diseases including rheumatoid arthritis, psoriasis and multiple sclerosis. The IL-17 receptor is a type I transmembrane protein, that is widely expressed on epithelial cells, fibroblasts, B and T cells, and monocytic cells. In psoriatic skin lesions, both Th17 cells and their downstream effector molecules, e.g. IL-17 and IL-22, are highly increased. Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg0624 Product name: Recombinant mouse IL-17A protein Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 26-158 aa of NM-010552 Sequence: AAIIPQSSACPNTEAKDFLQNVKVNLKVFNSLGAKVSSRRPSDYLNRSTSPWTLHRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILVLKREPESCPFTFRVEKMLVGVGCTCVASIVRQAA Predict reactive species Full Name: interleukin 17A Calculated Molecular Weight: 17 kDa GenBank Accession Number: NM-010552 Gene Symbol: Il17a Gene ID (NCBI): 16171 RRID: AB_3672149 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q62386 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2-8°C. Stable for one year after shipment.