Proteintech, 98015-1-RR, Anti-Mouse IL-21 Rabbit Recombinant Antibody

Size: 100ug The IL-21 (98015-1-RR) by Proteintech is a Recombinant antibody targeting IL-21 in FC (Intra) applications with reactivity to mouse samples 98015-1-RR targets IL-21 in FC (Intra) applications and shows reactivity with mouse samples. Tested Applications Positive FC (Intra) detected in: PMA, Ionomycin and Brefeldin A treated mouse splenocytes Recommended dilution Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in 100 μl suspension Background Information Interleukin 21 (IL-21) is a cytokine produced predominantly by cluster of differentiation 4 (CD4+) T-cells and natural killer T-cells. IL-21 is preliminarily expressed in activated cluster of differentiation 4 (CD4+) T-cells and natural killer (NK) T-cells. IL-21 receptor (IL-21R) is a class I cytokine receptor, which requires dimerization with the indispensable common gamma chain (γc) subunit to bind IL-21. IL-21 plays a role in both the innate and adaptive immune responses by inducing the differentiation, proliferation and activity of multiple target cells including macrophages, natural killer cells, B cells and cytotoxic T cells. IL-21 mediates apoptosis in B-CLL cells through up-regulation of the BIM (BH3 family member) and enhances both direct and antibody-dependent cellular cytotoxicity in these cells. Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg0234 Product name: recombinant mouse IL21 protein Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 25-146 aa of NM_001291041 Sequence: PDRLLIRLRHLIDIVEQLKIYENDLDPELLSAPQDVKGHCEHAAFACFQKAKLKPSNPGNNKTFIIDLVAQLRRRLPARRGGKKQKHIAKCPSCDSYEKRTPKEFLERLKWLLQKMIHQHLS Predict reactive species Full Name: interleukin 21 Calculated Molecular Weight: 17 aa GenBank Accession Number: NM_001291041 Gene Symbol: IL-21 Gene ID (NCBI): 60505 RRID: AB_3672158 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q9ES17 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2-8°C. Stable for one year after shipment.