Product Description
Size: 100ug
The IL-17F (98019-1-RR) by Proteintech is a Recombinant antibody targeting IL-17F in FC (Intra) applications with reactivity to mouse samples
98019-1-RR targets IL-17F in FC (Intra) applications and shows reactivity with mouse samples.
Tested Applications
Positive FC (Intra) detected in: PMA, Ionomycin and Brefeldin A treated mouse splenocytes
Recommended dilution
Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in 100 μl suspension
Background Information
The interleukin 17 (IL-17) family of cytokines contains 6 structurally related cytokines, IL-17A, IL-17B, IL-17C, IL-17D, IL-17E and IL-17F. IL-17 family plays crucial roles in host defense against microbial organisms and in the development of inflammatory diseases. IL-17A is a pro-inflammatory cytokine that also has the capacity to promote angiogenesis and osteoclastogenesis. IL-17F shares the highest homology with IL-17A and signals via a receptor composed by the IL-17RA and IL-17RC subunits. IL-17A and IL-17F can form IL-17A/A or IL-17F/F homodimers, IL-17A/F heterodimers are also formed. IL-17A and IL-17F, produced by the Th17 CD4(+) T cell lineage, have been linked to a variety of inflammatory and autoimmune conditions. IL-17F levels are elevated in sera and lesional psoriatic skin compared to non-lesional tissue. IL-17F also has been implicated in the development of neutrophilic airway inflammation.
Specification
Tested Reactivity: mouse
Host / Isotype: Rabbit / IgG
Class: Recombinant
Type: Antibody
Immunogen: CatNo: Eg0671 Product name: Recombinant Mouse IL-17F protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 29-161 aa of NM_145856.2 Sequence: RKNPKAGVPALQKAGNCPPLEDNTVRVDIRIFNQNQGISVPREFQNRSSSPWDYNITRDPHRFPSEIAEAQCRHSGCINAQGQEDSTMNSVAIQQEILVLRREPQGCSNSFRLEKMLLKVGCTCVKPIVHQAA Predict reactive species
Full Name: interleukin 17F
Calculated Molecular Weight: 17KD
GenBank Accession Number: NM_145856.2
Gene Symbol: IL-17F
Gene ID (NCBI): 257630
RRID: AB_3672163
Conjugate: Unconjugated
Form: Liquid
Purification Method: Protein A purfication
UNIPROT ID: Q7TNI7-1
Storage Buffer: PBS with 0.09% sodium azide, pH 7.3.
Storage Conditions: Store at 2-8°C. Stable for one year after shipment.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924