Proteintech, 98020-1-RR, Anti-Mouse CD14 Rabbit Recombinant Antibody

Size: 100ug The CD14 (98020-1-RR) by Proteintech is a Recombinant antibody targeting CD14 in IF/ICC, FC applications with reactivity to mouse samples 98020-1-RR targets CD14 in IF/ICC, FC applications and shows reactivity with mouse samples. Tested Applications Positive IF/ICC detected in: RAW 264.7 cells Positive FC detected in: mouse peritoneal macrophages Recommended dilution Immunofluorescence (IF)/ICC: IF/ICC : 1:125-1:500 Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in 100 μl suspension Background Information CD14 is a 50-55 kDa glycosylphosphatidylinositol-anchored glycoprotein preferentially expressed on monocytes and macrophages, and at lower levels on granulocytes (PMID: 3385210; 2462937; 7685797). CD14 can also exist as a soluble protein. CD14 acts as a co-receptor for bacterial liposaccharides (LPS) (PMID: 1698311). It plays a major role in the inflammatory response of monocytes to LPS. Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg0847 Product name: Recombinant mouse CD14 protein Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 16-345 aa of NM_009841.4 Sequence: SPAPPEPCELDEESCSCNFSDPKPDWSSAFNCLGAADVELYGGGRSLEYLLKRVDTEADLGQFTDIIKSLSLKRLTVRAARIPSRILFGALRVLGISGLQELTLENLEVTGTAPPPLLEATGPDLNILNLRNVSWATRDAWLAELQQWLKPGLKVLSIAQAHSLNFSCEQVRVFPALSTLDLSDNPELGERGLISALCPLKFPTLQVLALRNAGMETPSGVCSALAAARVQLQGLDLSHNSLRDAAGAPSCDWPSQLNSLNLSFTGLKQVPKGLPAKLSVLDLSYNRLDRNPSPDELPQVGNLSLKGNPFLDSESHSEKFNSGVVTAGAP Predict reactive species Full Name: CD14 antigen Calculated Molecular Weight: 39 kDa GenBank Accession Number: NM_009841.4 Gene Symbol: Cd14 Gene ID (NCBI): 12475 RRID: AB_3672164 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: P10810 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.