Proteintech, 98087-1-RR, Anti-Human IL-6 Rabbit Recombinant Antibody

Size: 100ug The IL-6 (98087-1-RR) by Proteintech is a Recombinant antibody targeting IL-6 in FC (Intra) applications with reactivity to human samples 98087-1-RR targets IL-6 in FC (Intra) applications and shows reactivity with human samples. Tested Applications Positive FC (Intra) detected in: LPS and Brefeldin A treated human PBMCs Recommended dilution Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in 100 μl suspension Background Information Interleukin-6 (IL-6) is an interleukin that acts as both a pro-inflammatory and anti-inflammatory cytokine. IL-6 protein is secreted by a variety of cell types including T cells and macrophages as phosphorylated and variably glycosylated molecule. IL-6 plays an essential role in the final differentiation of B-cells into Ig-secreting cells involved in lymphocyte and monocyte differentiation. It induces myeloma and plasmacytoma growth and induces nerve cells differentiation Acts on B-cells, T-cells, hepatocytes, hematopoietic progenitor cells and cells of the CNS. IL-6 is also considered a myokine, a cytokine produced from muscle, and is elevated in response to muscle contraction. IL-6 has been shown to interact with interleukin-6 receptor and glycoprotein 130. Additionally, IL-6 is involved in hematopoiesis, bone metabolism, and cancer progression, and has been defined an essential role in directing transition from innate to acquired immunity. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg0117 Product name: Recombinant Human IL-6 protein (Myc Tag, His Tag) Source: mammalian cells -derived, pHZ-KIsec Tag: Myc & 6*His Domain: 30-212 aa of BC015511 Sequence: VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM Predict reactive species Full Name: interleukin 6 (interferon, beta 2) Calculated Molecular Weight: 212 aa, 24 kDa GenBank Accession Number: BC015511 Gene Symbol: IL6 Gene ID (NCBI): 3569 ENSEMBL Gene ID: ENSG00000136244 RRID: AB_3672234 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: P05231 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.