Proteintech, 98114-1-RR, Anti-Mouse Tissue Factor/CD142 Rabbit Recombinant Antibody

Size: 100ug The Tissue Factor/CD142 (98114-1-RR) by Proteintech is a Recombinant antibody targeting Tissue Factor/CD142 in FC applications with reactivity to mouse samples 98114-1-RR targets Tissue Factor/CD142 in FC applications and shows reactivity with mouse samples. Tested Applications Positive FC detected in: LPS treated RAW 264.7 cells Recommended dilution Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information Normal blood coagulation is a complex process, involving a cascade of activation of different plasma proteins, ultimately resulting in the formation of a clot, called fibrin. Tissue Factor (TF), also named CD142, coagulation factor III or F3, is the primary initiator of the blood coagulation cascade and plays an essential role in hemostasis (PMID: 26877187; PMID: 33796108). Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg1102 Product name: Recombinant Mouse Tissue Factor protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 29-251 aa of Sequence: AGIPEKAFNLTWISTDFKTILEWQPKPTNYTYTVQISDRSRNWKNKCFSTTDTECDLTDEIVKDVTWAYEAKVLSVPRRNSVHGDGDQLVIHGEEPPFTNAPKFLPYRDTNLGQPVIQQFEQDGRKLNVVVKDSLTLVRKNGTFLTLRQVFGKDLGYIITYRKGSSTGKKTNITNTNEFSIDVEEGVSYCFFVQAMIFSRKTNQNSPGSSTVCTEQWKSFLGE Predict reactive species Full Name: coagulation factor III Calculated Molecular Weight: 33 kDa Gene Symbol: Tissue Factor Gene ID (NCBI): 14066 RRID: AB_3672261 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: P20352 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.