Proteintech, 98206-1-RR, Anti-Human IL-7 Rabbit Recombinant Antibody

Size: 100ug The IL-7 (98206-1-RR) by Proteintech is a Recombinant antibody targeting IL-7 in FC (Intra) applications with reactivity to human samples 98206-1-RR targets IL-7 in FC (Intra) applications and shows reactivity with human samples. Tested Applications Positive FC (Intra) detected in: Transfected HEK-293T cells Recommended dilution Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in 100 μl suspension Background Information Interleukin-7 (IL-7) is a cytokine involved in B and T cell development. It plays an active role in the development, survival, maintaining and restoring homeostasis of mature T lymphocytes and is a key regulator of the commitment, survival, proliferation and maturation of B cells during development. Furthermore, IL-7 can improve the antiviral function and expansion of natural killer (NK) cells and regulate the development and differentiation of dendritic cells. IL-7 has also been reported as a regulator of the development of central nervous system and myogenesis and skeletal muscle cell migration. (PMID: 29663382; 29655570; 29449560) Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg0830 Product name: Recombinant Human IL-7 protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 26-177 aa of NM_000880.4 Sequence: DCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH Predict reactive species Full Name: interleukin 7 Calculated Molecular Weight: 20 kDa GenBank Accession Number: NM_000880.4 Gene Symbol: IL-7 Gene ID (NCBI): 3574 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: P13232-1 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.