Proteintech, 98242-1-RR, Anti-Human CD68 Rabbit Recombinant Antibody

Size: 100ug The CD68 (98242-1-RR) by Proteintech is a Recombinant antibody targeting CD68 in FC (Intra) applications with reactivity to human samples 98242-1-RR targets CD68 in FC (Intra) applications and shows reactivity with human samples. Tested Applications Positive FC (Intra) detected in: human PBMCs Recommended dilution Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information CD68 is a type I transmembrane glycoprotein that is highly expressed by human monocytes and tissue macrophages. It belongs to the lysosomal/endosomal-associated membrane glycoprotein (LAMP) family and primarily localizes to lysosomes and endosomes with a smaller fraction circulating to the cell surface. CD68 is also a member of the scavenger receptor family. It may play a role in phagocytic activities of tissue macrophages. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg2061 Product name: Recombinant Human CD68 protein (rFc Tag)(HPLC verified) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 22-319 aa of BC015557 Sequence: NDCPHKKSATLLPSFTVTPTVTESTGTTSHRTTKSHKTTTHRTTTTGTTSHGPTTATHNPTTTSHGNVTVHPTSNSTATSQGPSTATHSPATTSHGNATVHPTSNSTATSPGFTSSAHPEPPPPSPSPSPTSKETIGDYTWTNGSQPCVHLQAQIQIRVMYTTQGGGEAWGISVLNPNKTKVQGSCEGAHPHLLLSFPYGHLSFGFMQDLQQKVVYLSYMAVEYNVSFPHAAQWTFSAQNASLRDLQAPLGQSFSCSNSSIILSPAVHLDLLSLRLQAAQLPHTGVFGQSFSCPSDRS Predict reactive species Full Name: CD68 molecule Calculated Molecular Weight: 37 kDa GenBank Accession Number: BC015557 Gene Symbol: CD68 Gene ID (NCBI): 968 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: P34810 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.