Proteintech, 98310-2-RR, Anti-Rat IL-1 beta Rabbit Recombinant Antibody

Size: 100ug The IL-1 beta (98310-2-RR) by Proteintech is a Recombinant antibody targeting IL-1 beta in FC (Intra) applications with reactivity to rat samples 98310-2-RR targets IL-1 beta in FC (Intra) applications and shows reactivity with rat samples. Tested Applications Positive FC (Intra) detected in: Transfected HEK-293T cells Recommended dilution Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in 100 μl suspension Background Information Interleukin-1, produced mainly by blood monocytes, mediates the panoply of host reactions collectively known as acute phase response. It is identical to endogenous pyrogen. The multiple biologic activities that define IL1 are properties of a 15- to 18-kD protein that is derived from a 30- to 35-kD precursor. Interleukin 1β (IL-1B) is a member of the interleukin 1 cytokine family. It is a pro-inflammatory cytokine against infection, playing an important role in the pathogenesis of cancers. It signals through various adaptor proteins and kinases that lead to activation of numerous downstream targets. Specification Tested Reactivity: rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg31371 Product name: Recombinant Rat IL-1 beta protein (Myc Tag, His Tag) Source: mammalian cells -derived, pHZ-KIsec Tag: Myc & 6*His Domain: 117-268 aa of NM_031512 Sequence: VPIRQLHCRLRDEQQKCLVLSDPCELKALHLNGQNISQQVVFSMSFVQGETSNDKIPVALGLKGLNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKTKVEFESAQFPNWYISTSQAEHRPVFLGNSNGRDIVDFTMEPVSS Predict reactive species Full Name: interleukin 1 beta Calculated Molecular Weight: 31 kDa GenBank Accession Number: NM_031512 Gene Symbol: IL-1 beta Gene ID (NCBI): 24494 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q63264 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.