Proteintech, 98368-2-RR, Anti-Human CD207 Rabbit Recombinant Antibody

Size: 100ug The CD207 (98368-2-RR) by Proteintech is a Recombinant antibody targeting CD207 in FC (Intra) applications with reactivity to human samples 98368-2-RR targets CD207 in FC (Intra) applications and shows reactivity with human samples. Tested Applications Positive FC (Intra) detected in: GM-CSF, IL-4 and TGF-β treated human PBMCs Recommended dilution Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in 100 μl suspension Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg2333 Product name: Recombinant Human CD207 protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-N-rFc Tag: N-rFc Domain: 65-328 aa of BC022278 Sequence: PRFMGTISDVKTNVQLLKGRVDNISTLDSEIKKNSDGMEAAGVQIQMVNESLGYVRSQFLKLKTSVEKANAQIQILTRSWEEVSTLNAQIPELKSDLEKASALNTKIRALQGSLENMSKLLKRQNDILQVVSQGWKYFKGNFYYFSLIPKTWYSAEQFCVSRNSHLTSVTSESEQEFLYKTAGGLIYWIGLTKAGMEGDWSWVDDTPFNKVQSVRFWIPGEPNNAGNNEHCGNIKAPSLQAWNDAPCDKTFLFICKRPYVPSEP Predict reactive species Full Name: CD207 molecule, langerin Calculated Molecular Weight: 328 aa, 37 kDa GenBank Accession Number: BC022278 Gene Symbol: CD207 Gene ID (NCBI): 50489 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9UJ71 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.