Iright
BRAND / VENDOR: Proteintech

Proteintech, 98407-3-RR, Anti-Mouse IL-13RA2 Rabbit Recombinant Antibody

CATALOG NUMBER: 98407-3-RR
السعر العادي$0.99
/
  • ddddd

    99 xxxxxx

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 100ug The IL-13RA2 (98407-3-RR) by Proteintech is a Recombinant antibody targeting IL-13RA2 in FC applications with reactivity to mouse samples 98407-3-RR targets IL-13RA2 in FC applications and shows reactivity with mouse samples. Tested Applications Positive FC detected in: Transfected HEK-293T cells Recommended dilution Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information IL-13RA2, also named as IL-13R and CD213a2, belongs to the type I cytokine receptor family. It binds as a monomer with high affinity to interleukin-13 (IL13), but not to interleukin-4 (IL4). IL-13RA2 lacks the cytoplasmic domain for signaling, indicating that it acts as a decoy receptor. IL-13RA2 gene polymorphisms have been associated with systemic sclerosis (PMID: 16981293). Overexpression of IL-13RA2 gene has been reported in several types of cancer, including melanoma, lung cancer, and brain tumor, which makes it a potential immunotherapeutic target (PMID: 19895199; 24970476; 24021875). Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg3118 Product name: Recombinant Mouse IL-13RA2 protein (rFc Tag) (HPLC verified) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 22-334 aa of NM_008356.4 Sequence: LEIKVNPPQDFEILDPGLLGYLYLQWKPPVVIEKFKGCTLEYELKYRNVDSDSWKTIITRNLIYKDGFDLNKGIEGKIRTHLSEHCTNGSEVQSPWIEASYGISDEGSLETKIQDMKCIYYNWQYLVCSWKPGKTVYSDTNYTMFFWYEGLDHALQCADYLQHDEKNVGCKLSNLDSSDYKDFFICVNGSSKLEPIRSSYTVFQLQNIVKPLPPEFLHISVENSIDIRMKWSTPGGPIPPRCYTYEIVIREDDISWESATDKNDMKLKRRANESEDLCFFVRCKVNIYCADDGIWSEWSEEECWEGYTGPDSK Predict reactive species Full Name: interleukin 13 receptor, alpha 2 Calculated Molecular Weight: 44 kDa GenBank Accession Number: NM_008356.4 Gene Symbol: Il13ra2 Gene ID (NCBI): 16165 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O88786-1 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924