Proteintech, 98413-1-RR, Anti-Human CD302 Rabbit Recombinant Antibody

Size: 100ug The CD302 (98413-1-RR) by Proteintech is a Recombinant antibody targeting CD302 in FC applications with reactivity to human samples 98413-1-RR targets CD302 in FC applications and shows reactivity with human samples. Tested Applications Positive FC detected in: human PBMCs Recommended dilution Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg2671 Product name: Recombinant Human CD302 protein (rFc Tag) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 23-168 aa of NM_014880.5 Sequence: DCPSSTWIQFQDSCYIFLQEAIKVESIEDVRNQCTDHGADMISIHNEEENAFILDTLKKQWKGPDDILLGMFYDTDDASFKWFDNSNMTFDKWTDQDDDEDLVDTCAFLHIKTGEWKKGNCEVSSVEGTLCKTAIPYKRKYLSDNH Predict reactive species Full Name: CD302 molecule Calculated Molecular Weight: 26 kDa GenBank Accession Number: NM_014880.5 Gene Symbol: CD302 Gene ID (NCBI): 9936 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q8IX05-1 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.