Proteintech, 98430-1-RR, Anti-Rat Fas Ligand/CD178 Rabbit Recombinant Antibody

Size: 100ug The Fas Ligand/CD178 (98430-1-RR) by Proteintech is a Recombinant antibody targeting Fas Ligand/CD178 in FC applications with reactivity to rat samples 98430-1-RR targets Fas Ligand/CD178 in FC applications and shows reactivity with rat samples. Tested Applications Positive FC detected in: Transfected HEK-293T cells Recommended dilution Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information CD178, also known as Fas ligand, is a type II transmembrane protein that belongs to the tumor necrosis factor (TNF) family. It is expressed on NK cells, cytotoxic T lymphocytes and activated CD4+ Th1 cells. CD178 transduces apoptotic signal into cells by binding to FAS/CD95. It is involved as a death factor in the regulation of activation-induced cell death, establishment of immune privilege and tumor cell survival. Specification Tested Reactivity: rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg3218 Product name: Recombinant Rat Fas Ligand/TNFSF6 protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-N-rFc Tag: N-rFc Domain: 103-278 aa of NM_012908.1 Sequence: HLQKELAELREFTNHSLRVSSFEKQIANPSTPSETKKPRSVAHLTGNPRSRSIPLEWEDTYGTALISGVKYKKGGLVINEAGLYFVYSKVYFRGQSCNSQPLSHKVYMRNFKYPGDLVLMEEKKLNYCTTGQIWAHSSYLGAVFNLTVADHLYVNISQLSLINFEESKTFFGLYKL Predict reactive species Full Name: Fas ligand (TNF superfamily, member 6) Calculated Molecular Weight: 31 kDa GenBank Accession Number: NM_012908.1 Gene Symbol: Faslg Gene ID (NCBI): 25385 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P36940 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.