Proteintech, 98467-2-RR, Anti-Mouse S100A8 Rabbit Recombinant Antibody

Size: 100ug The S100A8 (98467-2-RR) by Proteintech is a Recombinant antibody targeting S100A8 in FC (Intra) applications with reactivity to mouse samples 98467-2-RR targets S100A8 in FC (Intra) applications and shows reactivity with mouse samples. Tested Applications Positive FC (Intra) detected in: Transfected HEK-293T cells Recommended dilution Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information S100A8 is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in the inhibition of casein kinase and as a cytokine. Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg2959 Product name: recombinant mouse S100a8 protein Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 2-89 aa of NM_013650.2 Sequence: PSELEKALSNLIDVYHNYSNIQGNHHALYKNDFKKMVTTECPQFVQNINIENLFRELDINSDNAINFEEFLAMVIKVGVASHKDSHKE Predict reactive species Full Name: S100 calcium binding protein A8 (calgranulin A) Calculated Molecular Weight: 10 kDa GenBank Accession Number: NM_013650.2 Gene Symbol: S100a8 Gene ID (NCBI): 20201 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P27005 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.