Proteintech, 98477-1-RR, Anti-Human LILRA5/CD85f Rabbit Recombinant Antibody

Size: 100ug The LILRA5/CD85f (98477-1-RR) by Proteintech is a Recombinant antibody targeting LILRA5/CD85f in FC applications with reactivity to human samples 98477-1-RR targets LILRA5/CD85f in FC applications and shows reactivity with human samples. Tested Applications Positive FC detected in: human PBMCs Recommended dilution Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information LILRA5, also named as CD85f, ILT11, LILRB7 or LIR9, is a member of the leukocyte immunoglobulin-like receptor (LIR) family, which is a group of immune inhibitory and stimulatory receptors (PMID: 15304001). There are two membrane-bound and two soluble forms of LILRA5. The transmembrane LILRA5 contains a short cytoplasmic domain and a charged arginine residue within the transmembrane region (PMID: 19009525). It is mostly expressed in myeloid cells, including monocytes and neutrophils (PMID: 12393390). LILRA5 may play a role in triggering innate immune responses. It does not function in class I MHC antigens recognition (PMID: 16675463). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg2737 Product name: Recombinant Human LILRA5/CD85f protein (rFc Tag) (HPLC verified) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 42-268 aa of NM_021250.4 Sequence: GNLSKATLWAEPGSVISRGNSVTIRCQGTLEAQEYRLVKEGSPEPWDTQNPLEPKNKARFSIPSMTEHHAGRYRCYYYSPAGWSEPSDPLELVVTGFYNKPTLSALPSPVVTSGENVTLQCGSRLRFDRFILTEEGDHKLSWTLDSQLTPSGQFQALFPVGPVTPSHRWMLRCYGSRRHILQVWSEPSDLLEIPVSGAADNLSPSQNKSDSGTASHLQDYAVENLIR Predict reactive species Full Name: leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 5 Calculated Molecular Weight: 33 kDa GenBank Accession Number: NM_021250.4 Gene Symbol: LILRA5 Gene ID (NCBI): 353514 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: A6NI73-1 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.