Proteintech, 98479-1-RR, Anti-Human LILRA6/CD85b Rabbit Recombinant Antibody

Size: 100ug The LILRA6/CD85b (98479-1-RR) by Proteintech is a Recombinant antibody targeting LILRA6/CD85b in FC applications with reactivity to human samples 98479-1-RR targets LILRA6/CD85b in FC applications and shows reactivity with human samples. Tested Applications Positive FC detected in: human peripheral blood leukocytes Recommended dilution Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information Leukocyte immunoglobulin-like receptor subfamily A member 6 belongs to the leukocyte immunoglobulin-like receptors (LILRs, also known as ILTs and LIRs). Among 11 family members, inhibitory LILRB3 (ILT5, LIR3) and activating LILRA6 (ILT8) represent a unique homologous receptor pair characterized by highly polymorphic ectodomains. (PMID: 36449053; 24257760) Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg3776 Product name: Recombinant Human LILRA6 protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 24-447 aa of BC156794 Sequence: GPFPKPTLWAEPGSVISWGSPVTIWCQGSLEAQEYQLDKEGSPEPLDRNNPLEPKNKARFSIPSMTQHHAGRYRCHYYSSAGWSEPSDPLELVMTGFYNKPTLSALPSPVVASGGNMTLRCGSQKGYHHFVLMKEGEHQLPRTLDSQQLHSGGFQALFPVGPVTPSHRWRFTCYYYYTNTPRVWSHPSDPLEILPSGVSRKPSLLTLQGPVLAPGQSLTLQCGSDVGYDRFVLYKEGERDFLQRPGQQPQAGLSQANFTLGPVSPSHGGQYRCYGAHNLSSEWSAPSDPLNILMAGQIYDTVSLSAQPGPTVASGENVTLLCQSRGYFDTFLLTKEGAAHPPLRLRSMYGAHKYQAEFPMSPVTSAHAGTYRCYGSYSSNPHLLSFPSEPLELMVSGHSGGSSLPPTGPPSTPASHAKDYTVEN Predict reactive species Full Name: leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 6 GenBank Accession Number: BC156794 Gene Symbol: LILRA6 Gene ID (NCBI): 79168 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q6PI73 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.