Proteintech, 98488-3-RR, Anti-Human LILRB2/CD85d Rabbit Recombinant Antibody

Size: 100ug The LILRB2/CD85d (98488-3-RR) by Proteintech is a Recombinant antibody targeting LILRB2/CD85d in FC applications with reactivity to human samples 98488-3-RR targets LILRB2/CD85d in FC applications and shows reactivity with human samples. Tested Applications Positive FC detected in: human PBMCs Recommended dilution Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information LILRB2 (Leukocyte immunoglobulin-like receptor subfamily B member 2), also known as ILT4, CD85d or MIR10, is a type I transmembrane glycoprotein that contains four extracellular immunoglobulin domains, a transmembrane domain, and three cytoplasmic immunoreceptor tyrosine-based inhibitory motifs (ITIMs) (PMID: 33928233). LILRB2 is mainly expressed in immunocytes including monocytes, macrophages, and dendritic cells, and transduces negative signals by its association with SHP-1 phosphatase via the ITIMs (PMID: 35717259). LILRB2 can interact with various ligands such as HLA-A, HLA-B, HLA-C, HLA-G, HLA-F, CD1c, CD1d, angiopoietin-like proteins (ANGPTLs), and SEMA4A. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg2839 Product name: recombinant human LILRB2 protein Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 22-458 aa of NM_005874.4 Sequence: QTGTIPKPTLWAEPDSVITQGSPVTLSCQGSLEAQEYRLYREKKSASWITRIRPELVKNGQFHIPSITWEHTGRYGCQYYSRARWSELSDPLVLVMTGAYPKPTLSAQPSPVVTSGGRVTLQCESQVAFGGFILCKEGEDEHPQCLNSQPHARGSSRAIFSVGPVSPNRRWSHRCYGYDLNSPYVWSSPSDLLELLVPGVSKKPSLSVQPGPVMAPGESLTLQCVSDVGYDRFVLYKEGERDLRQLPGRQPQAGLSQANFTLGPVSRSYGGQYRCYGAHNLSSECSAPSDPLDILITGQIRGTPFISVQPGPTVASGENVTLLCQSWRQFHTFLLTKAGAADAPLRLRSIHEYPKYQAEFPMSPVTSAHAGTYRCYGSLNSDPYLLSHPSEPLELVVSGPSMGSSPPPTGPISTPAGPEDQPLTPTGSDPQSGLGRH Predict reactive species Full Name: leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 2 Calculated Molecular Weight: 65 kDa GenBank Accession Number: NM_005874.4 Gene Symbol: LILRB2 Gene ID (NCBI): 10288 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q8N423-1 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.