Proteintech, 98492-3-RR, Anti-Mouse Podoplanin Rabbit Recombinant Antibody

Size: 100ug The Podoplanin (98492-3-RR) by Proteintech is a Recombinant antibody targeting Podoplanin in FC applications with reactivity to mouse samples 98492-3-RR targets Podoplanin in FC applications and shows reactivity with mouse samples. Tested Applications Positive FC detected in: C2C12 cells Recommended dilution Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information Podoplanin was identified as a glycoprotein found in the cell membranes of glomerular epithelial cells (podocyte) (PMID: 9327748). It is a lymphatic marker because the expression of podoplanin has been detected in lymphatic but not blood vascular endothelium, and is useful as the marker of tumor-associated Lymphangiogenesis. Podoplanin has a function in developing testis, most likely at the level of cell-cell interactions among pre-meiotic germ cells and immature Sertoli cells. It may be involved in cell migration and/or actin cytoskeleton organization. When expressed in keratinocytes, Podoplanin induces changes in cell morphology with transfected cells showing an elongated shape, numerous membrane protrusions, major reorganization of the actin cytoskeleton, increased motility and decreased cell adhesion. It is required for normal lung cell proliferation and alveolus formation at birth. Podoplanin induces platelet aggregation. It does not have any effect on folic acid or amino acid transport and does not function as a water channel or as a regulator of aquaporin-type water channels. Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg2861 Product name: Recombinant Mouse Podoplanin/PDPN protein (rFc Tag)(HPLC verified) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 21-133 aa of NM_010329.3 Sequence: QGGTIGVNEDDIVTPGTGDGMVPPGIEDKITTTGATGGLNESTGKAPLVPTQRERGTKPPLEELSTSATSDHDHREHESTTTVKVVTSHSVDKKTSHPNRDNAGDETQTTDKK Predict reactive species Full Name: podoplanin Calculated Molecular Weight: 18 kDa GenBank Accession Number: NM_010329.3 Gene Symbol: Pdpn Gene ID (NCBI): 14726 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q62011 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.