Proteintech, 98500-1-RR, Anti-Rat CCL20/MIP-3 alpha Rabbit Recombinant Antibody

Size: 100ug The CCL20/MIP-3 alpha (98500-1-RR) by Proteintech is a Recombinant antibody targeting CCL20/MIP-3 alpha in FC (Intra) applications with reactivity to rat samples 98500-1-RR targets CCL20/MIP-3 alpha in FC (Intra) applications and shows reactivity with rat samples. Tested Applications Positive FC (Intra) detected in: Transfected HEK-293T cells Recommended dilution Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information CCL20, also known as macrophage infiltrating factor protein 3α, is a C-C chemokine that specifically binds to the receptor CCR6. CCL20 is produced in various tissues and by a wide range of immune cells, including neutrophils, natural killer cells, T-helper type 17 (Th17) cells, B cells, and various antigen-presenting cells, such as dendritic cells (DCs), Langerhans cells, and macrophages. Increased expression of CCL20 is likely involved in the increased recruitment of dendritic cells observed in fibroinflammatory diseases such as chronic obstructive pulmonary disease (COPD). CCL20 expression is increased by the proinflammatory cytokine IL-1 beta. Specification Tested Reactivity: rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg3237 Product name: Recombinant Rat CCL20/MIP-3 alpha protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 27-96 aa of NM_019233.1 Sequence: SNFDCCLTYTKNVYHHARNFVGFTTQMADEACDINAIIFHLKSKRSVCADPKQIWVKRILHLLSLRTKKM Predict reactive species Full Name: chemokine (C-C motif) ligand 20 Calculated Molecular Weight: 11 kDa GenBank Accession Number: NM_019233.1 Gene Symbol: Ccl20 Gene ID (NCBI): 29538 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P97884 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.