Proteintech, 98524-3-RR, Anti-Human OLR1/LOX1 Rabbit Recombinant Antibody

Size: 100ug The OLR1/LOX1 (98524-3-RR) by Proteintech is a Recombinant antibody targeting OLR1/LOX1 in FC applications with reactivity to human samples 98524-3-RR targets OLR1/LOX1 in FC applications and shows reactivity with human samples. Tested Applications Positive FC detected in: GM-CSF treated human PBMCs Recommended dilution Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information OLR1/LOX-1 acts as a receptor, in the form of homodimer, that mediates the recognition, internalization, and degradation of oxidatively modified low density lipoprotein (oxLDL) (PMID: 9052782, 15695803). ORL1 is predominantly expressed in endothelial cells and vascular-rich organs such as the placenta, lung, liver, and brain (PMID: 9828121). OLR1 is a protein containing 273 amino acids with a calculated molecular mass of 31 kDa but an apparent molecular mass of 50 kDa, which may result from the glycosylation of four potential N-linked glycosylation sites located at the C-terminal domain (PMID: 9052782). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg2911 Product name: Recombinant Human OLR1/LOX1 protein (rFc Tag) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 61-273 aa of NM_002543.3 Sequence: SQVSDLLTQEQANLTHQKKKLEGQISARQQAEEASQESENELKEMIETLARKLNEKSKEQMELHHQNLNLQETLKRVANCSAPCPQDWIWHGENCYLFSSGSFNWEKSQEKCLSLDAKLLKINSTADLDFIQQAISYSSFPFWMGLSRRNPSYPWLWEDGSPLMPHLFRVRGAVSQTYPSGTCAYIQRGAVYAENCILAAFSICQKKANLRAQ Predict reactive species Full Name: oxidized low density lipoprotein (lectin-like) receptor 1 Calculated Molecular Weight: 31 kDa GenBank Accession Number: NM_002543.3 Gene Symbol: OLR1 Gene ID (NCBI): 4973 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P78380-1 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.