Proteintech, 98536-3-RR, Anti-Mouse IL-25/IL-17E Rabbit Recombinant Antibody

Size: 100ug The IL-25/IL-17E (98536-3-RR) by Proteintech is a Recombinant antibody targeting IL-25/IL-17E in FC (Intra) applications with reactivity to mouse samples 98536-3-RR targets IL-25/IL-17E in FC (Intra) applications and shows reactivity with mouse samples. Tested Applications Positive FC (Intra) detected in: Transfected HEK-293T cells Recommended dilution Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg3316 Product name: recombinant mouse IL25/IL-17E protein Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 17-169 aa of NM_080729.3 Sequence: VSLRIQEGCSHLPSCCPSKEQEPPEEWLKWSSASVSPPEPLSHTHHAESCRASKDGPLNSRAISPWSYELDRDLNRVPQDLYHARCLCPHCVSLQTGSHMDPLGNSVPLYHNQTVFYRRPCHGEEGTHRRYCLERRLYRVSLACVCVRPRVMA Predict reactive species Full Name: interleukin 25 Calculated Molecular Weight: 19KD GenBank Accession Number: NM_080729.3 Gene Symbol: Il25 Gene ID (NCBI): 140806 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q8VHH8 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.