Proteintech, 98541-1-RR, Anti-Mouse SLAMF6 Rabbit Recombinant Antibody

Size: 100ug The SLAMF6 (98541-1-RR) by Proteintech is a Recombinant antibody targeting SLAMF6 in FC applications with reactivity to mouse samples 98541-1-RR targets SLAMF6 in FC applications and shows reactivity with mouse samples. Tested Applications Positive FC detected in: mouse splenocytes Recommended dilution Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information Signaling lymphocyte activation molecule 6 (SLAMF6) (Ly108 in mice, NTB-A or SF2000 in humans) is a homophilic receptor belonging to the superfamily immunoglobulin (Ig) domain-containing molecules (PMID:31199820). SLAMF6 is a type I transmembrane protein with two extracellular immunoglobins (Ig)-like domains and three cytoplasmic tyrosine-based signaling motifs, one of which is immunoreceptor tyrosine-based switch motif (PMID:31315913). SLAMF6 is expressed on a wide variety of immune cells including T cells (also TFH), B cells, NK cells (expressed in humans only), double positive thymocytes, eosinophils, and neutrophils (mouse only) (PMID:11862385). Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg5249 Product name: recombinant mouse SLAMF6/CD352 protein Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 31-239 aa of NM_030710.2 Sequence: EVSQSSSDPQLMNGVLGESAVLPLKLPAGKIANIIIWNYEWEASQVTALVINLSNPESPQIMNTDVKKRLNITQSYSLQISNLTMADTGSYTAQITTKDSEVITFKYILRVFERLGNLETTNYTLLLENGTCQIHLACVLKNQSQTVSVEWQATGNISLGGPNVTIFWDPRNSGDQTYVCRAKNAVSNLSVSVSTQSLCKGVLTNPPWN Predict reactive species Full Name: SLAM family member 6 Calculated Molecular Weight: 36 kDa GenBank Accession Number: NM_030710.2 Gene Symbol: Slamf6 Gene ID (NCBI): 30925 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9ET39-2 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.