Proteintech, 98545-2-RR, Anti-Rat CD25/IL-2RA Rabbit Recombinant Antibody

Size: 100ug The CD25/IL-2RA (98545-2-RR) by Proteintech is a Recombinant antibody targeting CD25/IL-2RA in FC applications with reactivity to rat samples 98545-2-RR targets CD25/IL-2RA in FC applications and shows reactivity with rat samples. Tested Applications Positive FC detected in: ConA treated rat splenocytes Recommended dilution Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information Proliferation of T lymphocytes is triggered by the interaction of IL-2 with its specific receptor following T lymphocyte activation. The receptor for IL-2 has three forms, generated by different combinations of three different proteins, the alpha chain (IL-2R alpha), the beta chain (IL-2R beta), and the gamma chain (IL-2R gamma) (PMID: 8476561). IL-2R alpha (also known as CD25) is a type I transmembrane protein present on activated T cells, activated B cells, some thymocytes, myeloid precursors, and oligodendrocytes. CD25 is also found on natural CD4+Foxp3+ Treg cells and a subset of human CD4+ memory T cells (PMID: 22585674). Specification Tested Reactivity: rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg1453 Product name: recombinant rat CD25/IL-2R alpha protein Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 22-235 aa of NM_013163.1 Sequence: ELCLYDPPEVPNATFKALSYKNGTILNCECKRGFRRLNELVYMACLGNSWSNNCQCTSNSHDNSREQVTPQPEGQKEQQTTDTQKSTQSVYQENLAGHCREPPPWRHEDTKRIYHFVEGQIVLYTCIQGYKALQRGPAISICKTVCGEIRWTHPQLTCVDEKEHHQFLASEESQGSRNSFPESEASCPTPNTDFSQLTEATTTMETFVFTKEYQ Predict reactive species Full Name: interleukin 2 receptor, alpha Calculated Molecular Weight: 31kDa GenBank Accession Number: NM_013163.1 Gene Symbol: Il2ra Gene ID (NCBI): 25704 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P26897 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.