Proteintech, 98555-1-RR, Anti-Mouse CCL7/MCP-3 Rabbit Recombinant Antibody

Size: 100ug The CCL7/MCP-3 (98555-1-RR) by Proteintech is a Recombinant antibody targeting CCL7/MCP-3 in FC (Intra) applications with reactivity to mouse samples 98555-1-RR targets CCL7/MCP-3 in FC (Intra) applications and shows reactivity with mouse samples. Tested Applications Positive FC (Intra) detected in: Transfected HEK-293T cells Recommended dilution Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information The chemokine CCL7 (MCP3) is a chemotactic factor and potent attractant of monocytes firstly characterized from the culture supernatants of MG-63 osteosarcoma cells. CCL7 is known to promote the recruitment of many innate immune cell types including monocytes and neutrophils to sites of bacterial and viral infection and eosinophils and basophils to sites of allergic inflammation. CCL7 is expressed at low levels in endothelial cells, fibroblasts and mononuclear cells and upregulated by various stimuli including viruses, type I or type II interferons (IFNs). CCL7 (MCP-3) mediates effects on a host of innate and adaptive immune cell types through binding to numerous receptors including CCR1, CCR2, CCR3, CCR5, and CCR10. Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg4626 Product name: Recombinant Mouse CCL7/MCP-3 protein (rFc Tag) (HPLC verified) Source: mammalian cells -derived, pHZ-KIsec-N-rFc Tag: N-rFc Domain: 24-97 aa of NM_013654.3 Sequence: QPDGPNASTCCYVKKQKIPKRNLKSYRRITSSRCPWEAVIFKTKKGMEVCAEAHQKWVEEAIAYLDMKTPTPKP Predict reactive species Full Name: chemokine (C-C motif) ligand 7 Calculated Molecular Weight: 11kDa GenBank Accession Number: NM_013654.3 Gene Symbol: Ccl7 Gene ID (NCBI): 20306 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q03366 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.