Proteintech, 98564-1-RR, Anti-Rat IL-17A Rabbit Recombinant Antibody

Size: 100ug The IL-17A (98564-1-RR) by Proteintech is a Recombinant antibody targeting IL-17A in FC applications with reactivity to rat samples 98564-1-RR targets IL-17A in FC applications and shows reactivity with rat samples. Tested Applications Positive FC detected in: Transfected HEK-293T cells Recommended dilution Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information IL-17A, also named as IL-17, is a proinflammatory cytokine. IL-17, synthesized only by memory T cells and natural killer cells, has pleiotropic effects, mainly in the recruitment and activation of neutrophils. This cytokine regulates the activities of NF-kappaB and mitogen-activated protein kinases. This cytokine can stimulate the expression of IL6 and cyclooxygenase-2 (PTGS2/COX-2), as well as enhance the production of nitric oxide (NO). High levels of this cytokine are associated with several chronic inflammatory diseases including rheumatoid arthritis, psoriasis and multiple sclerosis. The IL-17 receptor is a type I transmembrane protein, that is widely expressed on epithelial cells, fibroblasts, B and T cells, and monocytic cells. In psoriatic skin lesions, both Th17 cells and their downstream effector molecules, e.g. IL-17 and IL-22, are highly increased. Specification Tested Reactivity: rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg3339 Product name: Recombinant Rat IL-17A protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 18-150 aa of Sequence: AVLIPQSSVCPNAEANNFLQNVKVNLKVINSLSSKASSRRPSDYLNRSTSPWTLSRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILVLKREPEKCPFTFRVEKMLVGVGCTCVSSIVRHAS Predict reactive species Full Name: similar to Interleukin-17 precursor (IL-17) (Cytotoxic T lymphocyte-associated antigen 8) (CTLA-8) Calculated Molecular Weight: 17kDa Gene Symbol: LOC301289 Gene ID (NCBI): 301289 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q61453 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.