Proteintech, 98581-4-RR, Anti-Mouse CD169 Rabbit Recombinant Antibody

Size: 100ug The CD169 (98581-4-RR) by Proteintech is a Recombinant antibody targeting CD169 in FC applications with reactivity to mouse samples 98581-4-RR targets CD169 in FC applications and shows reactivity with mouse samples. Tested Applications Positive FC detected in: mouse bone marrow cells Recommended dilution Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information CD169, also known as sheep erythrocyte receptor (SER), Sialoadhesin (Sn) or Siglec-1, is a sialic acid-binding immunoglobulin-like lectin that belongs to the SIGLEC family of the Ig superfamily (PMID: 3783087; 11133773). CD169 is a single-pass transmembrane protein containing a long extracellular domain, a transmembrane region, and a short cytoplasmic tail (PMID: 11133773). It is primarily expressed on the surface of specific macrophage subsets and its precursor monocytes, as well as on some DCs (PMID: 33408860). CD169 binds to sialic acid-containing glycoconjugates, particularly those with α(2,3)-linkages. It is involved in immune regulation, pathogen recognition, and cell-cell interactions. Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg5002 Product name: recombinant mouse Siglec1 protein Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 20-510 aa of NP_035556 Sequence: TWGVSSPKNVQGLSGSCLLIPCIFSYPADVPVSNGITAIWYYDYSGKRQVVIHSGDPKLVDKRFRGRAELMGNMDHKVCNLLLKDLKPEDSGTYNFRFEISDSNRWLDVKGTTVTVTTDPSPPTITIPEELREGMERNFNCSTPYLCLQEKQVSLQWRGQDPTHSVTSSFQSLEPTGVYHQTTLHMALSWQDHGRTLLCQFSLGAHSSRKEVYLQVPHAPKGVEILLSSSGRNILPGDPVTLTCRVNSSYPAVSAVQWARDGVNLGVTGHVLRLFSAAWNDSGAYTCQATNDMGSLVSSPLSLHVFMAEVKMNPAGPVLENETVTLLCSTPKEAPQELRYSWYKNHILLEDAHASTLHLPAVTRADTGFYFCEVQNAQGSERSSPLSVVVRYPPLTPDLTTFLETQAGLVGILHCSVVSEPLATVVLSHGGLTLASNSGENDFNPRFRISSAPNSLRLEIRDLQPADSGEYTCLAVNSLGNSTSSLDFYAN Predict reactive species Full Name: sialic acid binding Ig-like lectin 1, sialoadhesin Calculated Molecular Weight: 183 kDa GenBank Accession Number: NP_035556 Gene Symbol: Siglec1 Gene ID (NCBI): 20612 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q62230-1 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.