Iright
BRAND / VENDOR: Proteintech

Proteintech, 98702-2-RR, Anti-Pig IFN-gamma Rabbit Recombinant Antibody

CATALOG NUMBER: 98702-2-RR
السعر العادي$0.99
/
  • ddddd

    99 xxxxxx

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 100ug The IFN-gamma (98702-2-RR) by Proteintech is a Recombinant antibody targeting IFN-gamma in FC (Intra) applications with reactivity to pig samples 98702-2-RR targets IFN-gamma in FC (Intra) applications and shows reactivity with pig samples. Tested Applications Positive FC (Intra) detected in: Transfected CHO cells Recommended dilution Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information Interferon-gamma (IFN γ), is a type II interferon that provides immunity against bacterial, viral and protozoan infections. It is produced by a number of immune cell types including natural killer cells, natural killer T cells, and effector lymphocyte T cells following antigenic and inflammatory triggers. The IFN γ dimer binds to its cognate receptor which has two subunits: IFN-γR1 which is the ligand-binding chain (α chain) and IFN-γR2, the signal-transducing chain (β chain). Binding to the receptor activates the JAK/STAT pathway which in turn activates IFN γ responsive genes. While IFN γ can inhibit viral replication, it also works as an immune-modulator and immune-stimulator by increasing surface expression of class I MHC proteins (PMID: 19268625; 10688427) Specification Tested Reactivity: pig Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg4538 Product name: Recombinant Pig IFN-gamma protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 24-166 aa of NM_213948.1 Sequence: QAPFFKEITILKDYFNASTSDVPNGGPLFLEILKNWKEESDKKIIQSQIVSFYFKFFEIFKDNQAIQRSMDVIKQDMFQRFLNGSSGKLNDFEKLIKIPVDNLQIQRKAISELIKVMNDLSPRSNLRKRKRSQTMFQGQRASK Predict reactive species Full Name: Interferon gamma Calculated Molecular Weight: 19 kDa GenBank Accession Number: NM_213948.1 Gene Symbol: IFNG Gene ID (NCBI): 396991 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P17803 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924