Proteintech, G14972-1-5C, MultiPro® 5CFLX Anti-Human LEF1 (Polyclonal)

Size: 10ug The LEF1 (G14972-1-5C) by Proteintech is a Polyclonal antibody targeting LEF1 in Single Cell (Intra) applications with reactivity to Human samples G14972-1-5C targets LEF1 in Single Cell (Intra) applications and shows reactivity with Human samples. Tested Applications Positive Single Cell (Intra) detected in: 10x Genomics Gene Expression Flex with Feature Barcodes and Multiplexing product. Recommended dilution SINGLE CELL (INTRA): <0.5ug/test Background Information Lymphoid enhancer-binding factor 1(LEF1) belongs to a family of regulatory protein share homology with high mobility group protein-1, and it's a nuclear protein exprssed in pre-B and T cells. LEF1 has a role in the Wnt signaling pathway and hair cell differentiation and follicle morphogenesis. Together with CTNNB1 and EP300, LEF1 activates transcription of target genes. Isoform 5 transcriptionally activates the fibronectin promoter, binds to and represses transcription from the E-cadherin promoter in a CTNNB1-independent manner, and is involved in reducing cellular aggregation and increasing cell migration of pancreatic cancer cells. Isoform 1 transcriptionally activates MYC and CCND1 expression and enhances proliferation of pancreatic tumor cells. MECs can give rise to seven cell types of the SAE and SMGs following severe airway injury. MECs progressively adopted a basal cell phenotype on the SAE and established lasting progenitors capable of further regeneration following reinjury. MECs activate Wnt-regulated transcription factors (Lef-1/TCF7) following injury and Lef-1 induction in cultured MECs promoted transition to a basal cell phenotype. Surprisingly, dose-dependent MEC conditional activation of Lef-1in vivopromoted self-limited airway regeneration in the absence of injury. Thus, modulating the Lef-1 transcriptional program in MEC-derived progenitors may have regenerative medicine applications for lung diseases. (https://doi.org/10.1016/j.stem.2018.03.017) The phosphorylation may affects LEF1 protein's theoretical molecular weight when tested.40-70 kD bands have also been reported (PMID: 22261717; 17063141 ). Specification Tested Reactivity: Human Host / Isotype: Rabbit / IgG Class: Oligo Conjugate Type: Polyclonal Immunogen: CatNo: Ag6882 Product name: Recombinant human LEF1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-399 aa of BC050632 Sequence: MPQLSGGGGGGGGDPELCATDEMIPFKDEGDPQKEKIFAEISHPEEEGDLADIKSSLVNESEIIPASNGHEVARQAQTSQEPYHDKAREHPDDGKHPDGGLYNKGPSYSSYSGYIMMPNMNNDPYMSNGSLSPPIPRTSNKVPVVQPSHAVHPLTPLITYSDEHFSPGSHPSHIPSDVNSKQGMSRHPPAPDIPTFYPLSPGGVGQITPPLGWQGQPVYPITGGFRQPYPSSLSVDTSMSRFSHHMIPGPPGPHTTGIPHPAIVTPQVKQEHPHTDSDLMHVKPQHEQRKEQEPKRPHIKKPLNAFMLYMKEMRANVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKKRKREKLQESASGTGPRMTAAYI Predict reactive species Full Name: MultiPro® 5CFLX Anti-Human LEF1 (Polyclonal) Calculated Molecular Weight: 37 kDa GenBank Accession Number: BC050632 Gene Symbol: LEF1 Gene ID (NCBI): 51176 ENSEMBL Gene ID: ENSG00000138795 RRID: AB_3673889 Conjugate: 5CFLX Full Oligo Sequence: CGGAGATGTGTATAAGAGACAGCATACAGGCTGACAACCCATATAAGAAA Barcode Sequence: CATACAGGCTGACAA Form: Liquid UNIPROT ID: Q9UJU2 Storage Buffer: PBS with 1mM EDTA and 0.09% sodium azide , pH 7.3. Storage Conditions: 2-8°C Stable for one year after shipment.