Iright
BRAND / VENDOR: Biolegend

Biolegend, 446709, Recombinant Human Uncarboxylated Osteocalcin (ELISA Std.), 4pack

CATALOG NUMBER: 446709
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description

Osteocalcin is the most abundant non-collagenous protein found in the bone. While fully-carboxylated osteocalcin has a high affinity for the extracellular matrix of the bone; decreases in pH, caused by the process of bone resorption, result in decarboxylation of this protein. This generates both partially decarboxylated (undercarboxylated) and fully decarboxylated (uncarboxylated) osteocalcin molecules which are released into the circulation due to decreased affinity for the extracellular matrix. Fully carboxylated osteocalcin requires high calcium concentrations for proper protein folding; however, under/uncarboxylated osteocalcin has no calcium requirement to maintain its structure within the blood.
4pack
Source: YLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV (synthetic peptide)
Molecular Mass: 33.2 kD
Purity: > 90%
Formulation: Lyophilized in sterile-filtered PBS, pH 7.2, containing 1% BSA, 0.09% sodium azide, and protease inhibitors
Concentration: Lot-specific (to obtain lot-specific concentration and expiration, please enter the lot number in our Certificate of Analysis online tool.)
Storage & Handling: Unopened vials can be stored between 2°C and 8°C until the expiration date. Prior to use, reconstitute the lyophilized powder with 0.2 mL of PBS containing a carrier protein (e.g., 1% BSA, protease free), pH7.4. Re-cap vial, vortex. Allow the reconstituted standard to sit at room temperature for 15 minutes, vortex again to mix completely. The reconstituted standard stock solution can be aliquoted into polypropylene vials and stored at -70°C for up to one month. Do not re-use diluted standards. Avoid repeated freeze/thaw cycles.
Activity: YLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPVIt is a synthetic peptide (did not test activity)
Application: ELISA - Quality tested
Recommended Usage: Each lot of this protein is quality control tested by ELISA assay. For use as an ELISA standard, a standard curve comprised of doubling dilutions from 37.5 - 2400 pg/mL is suggested. It is recommended that the reagent be titrated for optimal performance for each application.
Application Notes: This Uncarboxylated Osteocalcin protein is useful as a standard for a human Osteocalcin sandwich ELISA, using unlabeled 8H4 antibody (Cat. No. 538202) as capture and biotinylated 4B6 antibody (Cat. No. 538304) as detection.
Structure: Monomer
Distribution: Osteocalcin is produced by osteoblasts as a 49 amino acid protein, which contains 3 glutamine acid residues (Glu 17, 21, and 24) that are gamma carboxylated in a vitamin K dependent manner.
Function: Once binded under/uncarboxylated forms act as hormones promoting β-cell proliferation, adiponectin secretion, insulin sensitivity, glucose tolerance, and testosterone biosynthesis. In patients with diabetes, reduced serum levels of osteocalcin are negatively correlated with obesity and insulin resistance. Furthermore, supporting studies in mice have suggested potential therapeutic applications for osteocalcin in both obesity and insulin resistance.
Interaction: GPRC6A, insulin, pancreatic β-cells, Ley-dig cells, adiponectin
Ligand/Receptor: Under/uncarboxylated forms can bind the receptor GPCR6a, calcium, and metal-binding.
Bioactivity: YLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPVImmunogen is a synthetic peptide (did not test activity)
Cell Type: Osteoblasts
Molecular Family: Hormones
Antigen References: Booth SL, et al. 2013. Nat Rev Endocrinol. 9:43. Diaz-Franco MC, et al. 2019. Mol Med Rep. 19:15-22. Karsenty G, et al. 2014. Mol Cell Endocrinol. 382:521. Zoch ML, et al. 2016. Bone. 82:42-9.
Gene ID: 632
UniProt: View information about Uncarboxylated Osteocalcin on UniProt.org
Regulatory Status: RUO
Other Names: Osteocalcin, uncarboxylated osteocalcin, decarboxylated osteocalcin, 3xGlu, bone gamma-carboxyglutamate protein, Bone Gla Protein, BGP, OC, OCN, unOCN


Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924