Iright
BRAND / VENDOR: Proteintech

Proteintech, 10108-2-AP, CX3CL1 Polyclonal antibody

CATALOG NUMBER: 10108-2-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CX3CL1 (10108-2-AP) by Proteintech is a Polyclonal antibody targeting CX3CL1 in WB, IHC, ELISA applications with reactivity to human samples 10108-2-AP targets CX3CL1 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: PC-3 cells, human brain tissue Positive IHC detected in: human small intestine tissue, human lung tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Background Information Chemokines direct the trafficking of white blood cells in immune surveillance, playing a key role in inflammatory and infectious diseases such as AIDS. The human CX3C chemokine carries the chemokine domain on top of an extended mucin-like stalk. CX3CL1 is synthesized as a 50-75 kDa precursor and undergoes glycosylation to yield two mature forms: a 100 kDa cell membrane bound form and an 85 kDa soluble form which is released from the cell surface. The soluble CX3C chemokine has potent chemoattractant activity for T cells and monocytes, and the cell-surface-bound protein, which is induced by primary proinflammatory signals in activated primary endothelial cells, promotes strong adhesion of those leukocytes. Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0161 Product name: Recombinant human CX3CL1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 90-245 aa of BC001163 Sequence: DRQAAALTRNGGTFEKQIGEVKPRTTPAAGGMDESVVLEPEATGESSSLEPTPSSQEAQRALGTSPELPTGVTGSSGTRLPPTPKAQDGGPVGTELFRVPPVSTAATWQSSAPHQPGPSLWAEAKTSEAPSTQDPSTQASTASSPAPEENAPSEGQ Predict reactive species Full Name: chemokine (C-X3-C motif) ligand 1 Calculated Molecular Weight: 42 kDa Observed Molecular Weight: 90-100 kDa GenBank Accession Number: BC001163 Gene Symbol: CX3CL1 Gene ID (NCBI): 6376 RRID: AB_2087154 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P78423 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924