Iright
BRAND / VENDOR: Proteintech

Proteintech, 10110-2-AP, PRC1 Polyclonal antibody

CATALOG NUMBER: 10110-2-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PRC1 (10110-2-AP) by Proteintech is a Polyclonal antibody targeting PRC1 in WB, IHC, ELISA applications with reactivity to human samples 10110-2-AP targets PRC1 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: MCF-7 cells, HEK-293 cells, HeLa cells, HepG2 cells Positive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:12000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information PRC1 is involved in cytokinesis. PRC1 is at high level during S and G2/M and drop dramatically after cell exit mitosis and enter G1. PRC1 is located in the nucleus during interphase, and becomes associated with mitotic spindles in a highly dynamic manner during mitosis, and localizes to the cell mid-body during cytokinesis. PRC1 is a good substrate for several cyclin-dependent kinases (CDKs) in vitro and is phosphorylated in vivo at sites that are phosphorylated by CDK in vitro, suggesting that PRC1 is an in vivo CDK substrate. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0163 Product name: Recombinant human PRC1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 13-175 aa of BC005140 Sequence: VCLQKALNHLREIWELIGIPEDQRLQRTEVVKKHIKELLDMMIAEEESLKERLIKSISVCQKELNTLCSELHVEPFQEEGETTILQLEKDLRTQVELMRKQKKERKQELKLLQEQDQELCEILCMPHYDIDSASVPSLEELNQFRQHVTTLRETKASRREEFV Predict reactive species Full Name: protein regulator of cytokinesis 1 Calculated Molecular Weight: 67 kDa Observed Molecular Weight: 67 kDa GenBank Accession Number: BC005140 Gene Symbol: PRC1 Gene ID (NCBI): 9055 RRID: AB_2252888 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O43663 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924