Iright
BRAND / VENDOR: Proteintech

Proteintech, 10169-2-AP, HSBP1 Polyclonal antibody

CATALOG NUMBER: 10169-2-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The HSBP1 (10169-2-AP) by Proteintech is a Polyclonal antibody targeting HSBP1 in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples 10169-2-AP targets HSBP1 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, human brain tissue, HT-1080 cells, rat brain tissue Positive IP detected in: mouse brain tissue Positive IHC detected in: mouse liver tissue, human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0225 Product name: Recombinant human HSBP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-76 aa of BC007515 Sequence: MAETDPKTVQDLTSVVQTLLQQMQDKFQTMSDQIIGRIDDMSSRIDDLEKNIADLMTQAGVEELESENKIPATQKS Predict reactive species Full Name: heat shock factor binding protein 1 Calculated Molecular Weight: 8.5 kDa Observed Molecular Weight: 60 kDa GenBank Accession Number: BC007515 Gene Symbol: HSBP1 Gene ID (NCBI): 3281 RRID: AB_2119501 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O75506 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924