Iright
BRAND / VENDOR: Proteintech

Proteintech, 10211-1-AP, HSPBP1 Polyclonal antibody

CATALOG NUMBER: 10211-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The HSPBP1 (10211-1-AP) by Proteintech is a Polyclonal antibody targeting HSPBP1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 10211-1-AP targets HSPBP1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, A549 cells, human heart tissue, human skeletal muscle tissue, human testis tissue, Jurkat cells, MCF-7 cells, mouse brain tissue, mouse testis tissue, rat testis tissue Positive IHC detected in: human kidney tissue, human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Hsp70-interacting protein (HSPBP1)is a protein of approximately 40 kilodaltons detected in cell extracts. Its mRNA is present in all tissues analyzed but is most abundant in heart and skeletal muscle. HSPBP1 binds the ATPase domain of Hsp70 and inhibits approximately 90% of the Hsp40-activated Hsp70 ATPase activity by preventing ATP binding to Hsp70. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0282 Product name: Recombinant human HSPBP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 139-359 aa of BC002373 Sequence: DFCQLSGMHLLVGRYLEAGAAGLRWRAAQLIGTCSQNVAAIQEQVLGLGALRKLLRLLDRDACDTVRVKALFAISCLVREQEAGLLQFLRLDGFSVLMRAMQQQVQKLKVKSAFLLQNLLVGHPEHKGTLCSMGMVQQLVALVRTEHSPFHEHVLGALCSLVTDFPQGVRECREPELGLEELLRHRCQLLQQHEEYQEELEFCEKLLQTCFSSPADDSMDR Predict reactive species Full Name: HSPA (heat shock 70kDa) binding protein, cytoplasmic cochaperone 1 Calculated Molecular Weight: 39 kDa Observed Molecular Weight: 39 kDa GenBank Accession Number: BC002373 Gene Symbol: HSPBP1 Gene ID (NCBI): 23640 RRID: AB_2121242 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NZL4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924