Proteintech, 10229-1-AP, SAE1 Polyclonal antibody

Size: 20ul / 150ul The SAE1 (10229-1-AP) by Proteintech is a Polyclonal antibody targeting SAE1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 10229-1-AP targets SAE1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A549 cells, A431 cells, HEK-293 cells, HeLa cells Positive IHC detected in: human colon cancer tissue, human skin cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:5000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information SAE1(SUMO-activating enzyme subunit 1) is also named as AOS1, SUA1, UBLE1A and belongs to the ubiquitin-activating E1 family. SAE1 has a calculated molecular mass of 38 kD. It had an apparent molecular mass of 40 kD by SDS-PAGE. SAE1 and UBA2 form a heterodimer that functions as a SUMO-activating enzyme for the sumoylation of proteins(PMID:9920803). Western blot analysis of synchronized HeLa cells detectes increased AOS1 expression as cells progressed through S phase, followed by a substantial decrease in G2 phase. Immunofluorescence analysis shows AOS1 and UBA2 distributed throughout nuclei, but they are excluded from nucleoli.(PMID:11481243). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0275 Product name: Recombinant human SAE1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-207 aa of BC000344 Sequence: MVEKEEAGGGISEEEAAQYDRQIRLWGLEAQKRLRASRVLLVGLKGLGAEIAKNLILAGVKGLTMLDHEQVTPEDPGAQFLIRTGSVGRNRAEASLERAQNLNPMVDVKVDTEDIEKKPESFFTQFDAVCLTCCSRDVIVKVDQICHKNSIKFFTGDVFGYHGYTFANLGEHEFVEEKTKVAKVSQGVEDGPDTKRAKLDSSETTMV Predict reactive species Full Name: SUMO1 activating enzyme subunit 1 Calculated Molecular Weight: 38 kDa Observed Molecular Weight: 38 kDa GenBank Accession Number: BC000344 Gene Symbol: SAE1 Gene ID (NCBI): 10055 RRID: AB_2182917 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UBE0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.