Iright
BRAND / VENDOR: Proteintech

Proteintech, 10231-1-AP, SMAD4 Polyclonal antibody

CATALOG NUMBER: 10231-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SMAD4 (10231-1-AP) by Proteintech is a Polyclonal antibody targeting SMAD4 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples 10231-1-AP targets SMAD4 in WB, IHC, IF, IP, CoIP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293T cells, COLO 320 cells, HEK-293 cells, mouse liver tissue, NIH/3T3 cells, HCT 116 cells, Neuro-2a cells, C6 cells Positive IP detected in: HeLa cells Positive IHC detected in: human skin cancer tissue, human tonsillitis tissue, human cervical cancer tissue, mouse pancreas tissue, rat small intestine tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information Mammalian homologs of the Drosophila Mad gene include Smad1, Smad2, Smad3, Smad4 (DPC4), Smad5, Smad6, Smad7 and Smad8. Smad1 and Smad5 are effectors of BMP2 and BMP4 function while Smad2 and Smad3 are involved in TGF and activin-mediated growth modulation. Smad4 has been shown to mediate all of the above activities through interaction with various Smad family members . Smad6 and Smad7 regulate the response to activin/ TGF signaling by interfering with TGF -mediated phosphorylation of other Smad family members. This antibody is a rabbit polyclonal antibody raised against an internal region of human SMAD4. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, pig, bovine, hamster, sheep, goat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0299 Product name: Recombinant human SMAD4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 13-227 aa of BC002379 Sequence: NDACLSIVHSLMCHRQGGESETFAKRAIESLVKKLKEKKDELDSLITAITTNGAHPSKCVTIQRTLDGRLQVAGRKGFPHVIYARLWRWPDLHKNELKHVKYCQYAFDLKCDSVCVNPYHYERVVSPGIDLSGLTLQSNAPSSMMVKDEYVHDFEGQPSLSTEGHSIQTIQHPPSNRASTETYSTPALLAPSESNATSTANFPNIPVASTSQPAS Predict reactive species Full Name: SMAD family member 4 Calculated Molecular Weight: 60 kDa Observed Molecular Weight: 63-70 kDa GenBank Accession Number: BC002379 Gene Symbol: SMAD4 Gene ID (NCBI): 4089 RRID: AB_2193323 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q13485 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924