Iright
BRAND / VENDOR: Proteintech

Proteintech, 10238-1-AP, PLEKHA1 Polyclonal antibody

CATALOG NUMBER: 10238-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PLEKHA1 (10238-1-AP) by Proteintech is a Polyclonal antibody targeting PLEKHA1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 10238-1-AP targets PLEKHA1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human placenta tissue, Jurkat cells Positive IHC detected in: human colon tissue, human pancreas cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Pleckstrin homology (PH) domain is commonly found in eukaryotic signaling proteins and possesses multiple functions including the abilities to bind inositol phosphates and various proteins. The tandem PH domain containing protein-1 (TAPP1) or PH domain containing-family A (phosphoinositide binding specific) member 1 (PLEKHA1), interacts strongly and specifically with phosphatidylinositol 3,4-trisphosphate [PtdIns(3,4)P(2)], which is one of the immediate breakdown products of PtdIns(3,4,5) P (3) and functions as a signalling molecule in insulin- and growth-factor-stimulated pathways. TAPP1 is also associated with the protein- tyrosine-phosphatase-like protein-1 (PTPL1 also known as FAP-1) and maintains PTPL1 in cytoplasm. By binding to PtdIns(3,4) P (2) and PTPL1, TAPP1 may regulate the membrane localization of PTPL1." Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0318 Product name: Recombinant human PLEKHA1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-193 aa of BC001136 Sequence: MPYVDRQNRICGFLDIEENENSGKFLRRYFILDTREDSFVWYMDNPQNLPSGSSRVGAIKLTYISKVSDATKLRPKAEFCFVMNAGMRKYFLQANDQQDLVEWVNVLNKAIKITVPKQSDSQPNSDNLSRHGECGKKQVSYRTDIVGGVPIITPTQKEEVNECGESIDRNNLKRSQSHLPYFTPKPPQDSAVI Predict reactive species Full Name: pleckstrin homology domain containing, family A (phosphoinositide binding specific) member 1 Calculated Molecular Weight: 46 kDa Observed Molecular Weight: 46 kDa GenBank Accession Number: BC001136 Gene Symbol: PLEKHA1 Gene ID (NCBI): 59338 RRID: AB_2163993 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9HB21 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924