Proteintech, 10261-1-AP, PRPF18 Polyclonal antibody

Size: 20ul / 150ul The PRPF18 (10261-1-AP) by Proteintech is a Polyclonal antibody targeting PRPF18 in WB, ELISA applications with reactivity to human samples 10261-1-AP targets PRPF18 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, L02 cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0329 Product name: Recombinant human PRPF18 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-47 aa of BC002572 Sequence: MDILKSEILRKRQLVEDRNLLREYVKANDAYLQMAIGNAPWPIGVTM Predict reactive species Full Name: PRP18 pre-mRNA processing factor 18 homolog (S. cerevisiae) Calculated Molecular Weight: 5 aa, 475 kDa Observed Molecular Weight: 37 kDa GenBank Accession Number: BC002572 Gene Symbol: PRPF18 Gene ID (NCBI): 8559 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q99633 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.