Iright
BRAND / VENDOR: Proteintech

Proteintech, 10264-1-AP, IL-11RA Polyclonal antibody

CATALOG NUMBER: 10264-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The IL-11RA (10264-1-AP) by Proteintech is a Polyclonal antibody targeting IL-11RA in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 10264-1-AP targets IL-11RA in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse colon tissue Positive IHC detected in: human prostate cancer tissue, mouse colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: N2a cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200 Background Information Interleukin-11 (IL-11), a member of the IL-6 family of cytokines, was firstly identified in bone marrow-derived stromal cells (PMID: 2145578). IL-11 is a multifunctional cytokine that plays important roles in hematopoiesis, bone development, tissue repair, and tumor development (PMID: 33863879). IL-10 signals through a receptor complex consisting of IL-11 receptor alpha subunit (IL-11RA) and gp130. IL-11RA binds IL-11 and gp130 transmits signals to the nucleus via Janus kinase (JAK) activation. In addition to a membrane-bound form, IL-11RA can also exist as a soluble form (sIL-11RA) that acts as an agonist of IL-11 activity (PMID: 26876177; 27493449). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0373 Product name: Recombinant human IL-11RA protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 184-361 aa of BC003110 Sequence: GAEFWSQYRINVTEVNPLGASTRLLDVSLQSILRPDPPQGLRVESVPGYPRRLRASWTYPASWPCQPHFLLKFRLQYRPAQHPAWSTVEPAGLEEVITDAVAGLPHAVRVSARDFLDAGTWSTWSPEAWGTPSTGTIPKEIPAWGQLHTQPEVEPQVDSPAPPRPSLQPHPRLLDHRD Predict reactive species Full Name: interleukin 11 receptor, alpha Calculated Molecular Weight: 45 kDa Observed Molecular Weight: 45 kDa GenBank Accession Number: BC003110 Gene Symbol: IL11RA Gene ID (NCBI): 3590 RRID: AB_2125660 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q14626 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924