Proteintech, 10265-1-AP, Histone H3.3 Polyclonal antibody

Size: 20ul / 150ul Histone H3.3 Polyclonal Antibody for WB, ELISA 10265-1-AP targets Histone H3.3 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Background Information Histones are the basic nuclear proteins responsible for the nucleosome structure of the chromosomal fiber. Five classes of histone genes have been reported, some of which are expressed only during S phase, while others are replication independent. The latter are referred to as replacement histones and are expressed in quiescent or terminally differentiated cells. H3F3B is one replacement histone [PMID: 8586426]. It constitutes the predominant form of histone H3 in non-dividing cells and is incorporated into chromatin independently of DNA synthesis. Deposited at sites of nucleosomal displacement throughout transcribed genes, suggesting that it represents an epigenetic imprint of transcriptionally active chromatin. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Thereby it has a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability [PMID: 14718166, 15776021]. Specification Tested Reactivity: human Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0326 Product name: Recombinant human H3F3B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 3-136 aa of BC001124 Sequence: RTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA Predict reactive species Full Name: H3 histone, family 3B (H3.3B) Calculated Molecular Weight: 15 kDa Observed Molecular Weight: 17 kDa GenBank Accession Number: BC001124 Gene Symbol: H3F3B Gene ID (NCBI): 3021 RRID: AB_513398 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P84243 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.