Proteintech, 10266-1-AP, IFN-gamma R2 Polyclonal antibody

Size: 20ul / 150ul The IFN-gamma R2 (10266-1-AP) by Proteintech is a Polyclonal antibody targeting IFN-gamma R2 in WB, IHC, IP, ELISA applications with reactivity to human samples 10266-1-AP targets IFN-gamma R2 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells, HeLa cells, HepG2 cells Positive IP detected in: A549 cells Positive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Interferon-gamam (IFN-γ) is a cytokine critical for innate and adaptive immunity against viral and intracellular bacterial infections and for tumor control. Cellular responses to IFN-γ are activated through its interaction with a heterodimeric receptor consisting of two subunits, IFNGR1 and IFNGR2. IFNGR1 is the ligand-binding subunit which binds IFN-γ with high affinity, whereas IFNGR2 serves as the accessory subunit which attaches to IFN-γ with a significantly lower affinity. Two subunits bind one IFN-γ dimer. Defects in IFNGR2 are a cause of mendelian susceptibility to mycobacterial disease (MSMD), also known as familial disseminated atypical mycobacterial infection. (PMID: 17981204; 946248; 10888113) Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0317 Product name: Recombinant human IFNGR2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 126-324 aa of BC003624 Sequence: WVTMPWFQHYRNVTVGPPENIEVTPGEGSLIIRFSSPFDIADTSTAFFCYYVHYWEKGGIQQVKGPFRSNSISLDNLKPSRVYCLQVQAQLLWNKSNIFRVGHLSNISCYETMADASTELQQVILISVGTFSLLSVLAGACFFLVLKYRGLIKYWFHTPPSIPLQIEEYLKDPTQPILEALDKDSSPKDDVWDSVSIIS Predict reactive species Full Name: interferon gamma receptor 2 (interferon gamma transducer 1) Calculated Molecular Weight: 45 kDa Observed Molecular Weight: 50-55 kDa GenBank Accession Number: BC003624 Gene Symbol: IFNGR2 Gene ID (NCBI): 3460 RRID: AB_2121709 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P38484 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.