Proteintech, 10272-2-AP, p19 INK4d Polyclonal antibody

Size: 20ul / 150ul The p19 INK4d (10272-2-AP) by Proteintech is a Polyclonal antibody targeting p19 INK4d in WB, IHC, ELISA applications with reactivity to human, mouse samples 10272-2-AP targets p19 INK4d in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse testis tissue Positive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0415 Product name: Recombinant human P19 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-166 aa of BC001822 Sequence: MLLEEVRAGDRLSGAAARGDVQEVRRLLHRELVHPDALNRFGKTALQVMMFGSTAIALELLKQGASPNVQDTSGTSPVHDAARTGFLDTLKVLVEHGADVNVPDGTGALPIHLAVQEGHTAVVSFLAAESDLHRRDARGLTPLELALQRGAQDLVDILQGHMVAPL Predict reactive species Full Name: cyclin-dependent kinase inhibitor 2D (p19, inhibits CDK4) Calculated Molecular Weight: 19 kDa Observed Molecular Weight: 18-20 kDa GenBank Accession Number: BC001822 Gene Symbol: p19 INK4d/CDKN2D Gene ID (NCBI): 1032 RRID: AB_2078742 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P55273 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.