Iright
BRAND / VENDOR: Proteintech

Proteintech, 10278-1-AP, TRAPB/SSR2 Polyclonal antibody

CATALOG NUMBER: 10278-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The TRAPB/SSR2 (10278-1-AP) by Proteintech is a Polyclonal antibody targeting TRAPB/SSR2 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 10278-1-AP targets TRAPB/SSR2 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HepG2 cells, L02 cells, mouse liver tissue, rat liver tissue Positive IHC detected in: human breast cancer tissue, human pancreas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information TRAPB (translocon-associated protein subunit beta), also known as SSR2 (signal sequence receptor subunit beta), is a 22-kDa single-spanning membrane glycoprotein of the endoplasmic reticulum (ER) (PMID: 7789174). It is a part of the tetrameric TRAP complex (TRAP-alpha, TRAP-beta, TRAP-delta and TRAP-gamma) which functions in regulating the retention of ER resident proteins (PMID: 7916687). The TRAP complex is also involved in endoplasmic reticulum-associated degradation (ERAD) (PMID: 17380188). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0304 Product name: Recombinant human TRAPB, SSR2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-175 aa of BC000341 Sequence: MRLLSFVVLALFAVTQAEEGARLLASKSLLNRYAVEGRDLTLQYNIYNVGSSAALDVELSDDSFPPEDFGIVSGMLNVKWDRIAPASNVSHTVVLRPLKAGYFNFTSATITYLAQEDGPVVIGSTSAPGQGGILAQREFDRRFSPHFLDWAAFGVMTLPSIGIPLLLWYSSKRKY Predict reactive species Full Name: signal sequence receptor, beta (translocon-associated protein beta) Calculated Molecular Weight: 20 kDa Observed Molecular Weight: 22-25 kDa GenBank Accession Number: BC000341 Gene Symbol: TRAPB Gene ID (NCBI): 6746 RRID: AB_2195624 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P43308 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924