Proteintech, 10286-1-AP, uPAR/CD87 Polyclonal antibody

Size: 20ul / 150ul The uPAR/CD87 (10286-1-AP) by Proteintech is a Polyclonal antibody targeting uPAR/CD87 in WB, IF/ICC, ELISA applications with reactivity to human, mouse samples 10286-1-AP targets uPAR/CD87 in WB, IHC, IF/ICC, CoIP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: RAW 264.7 cells, A2780 cells, U-251 cells, U-937 cells Positive IF/ICC detected in: U-251 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information uPAR is a 45-65 kDa, highly glycosylated, GPI-anchored membrane protein. In addition to the membrane-anchored form, uPAR is released from the plasma membrane by cleavage of the GPI anchor and can be found as a soluble form (suPAR). uPAR contains three homologous domains (D1-D3) of which the N-terminal one (D1) represents the uPA-binding domain. After binding to uPAR, uPA cleaves plasminogen, generating the active protease plasmin which is involved in a wide variety of physiologic and pathologic processes. In addition to regulating proteolysis, uPAR has important function in cell adhesion, migration and proliferation. Studies reveal that uPAR expression is elevated during inflammation and tissue remodelling and in many human cancers, in which it frequently indicates poor prognosis. (PMID 20027185; 12461559) Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, bovine Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0187 Product name: Recombinant human uPAR, PLAUR protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-136 aa of BC002788 Sequence: MGHPPLLPLLLLLHTCVPASWGLRCMQCKTNGDCRVEECALGQDLCRTTIVRLWEEGEELELVEKSCTHSEKTNRTLSYRTGLKITSLTEVVCGLDLCNQGNSGRAVTYSRSRYLECISCGSSDMSCERGRHQSLQ Predict reactive species Full Name: PLAUR Calculated Molecular Weight: 37 kDa Observed Molecular Weight: 35-50 kDa GenBank Accession Number: BC002788 Gene Symbol: uPAR Gene ID (NCBI): 5329 RRID: AB_10667460 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q03405 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.