Iright
BRAND / VENDOR: Proteintech

Proteintech, 10287-2-AP, CYPC Polyclonal antibody

CATALOG NUMBER: 10287-2-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CYPC (10287-2-AP) by Proteintech is a Polyclonal antibody targeting CYPC in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 10287-2-AP targets CYPC in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, HuH-7 cells, HEK-293 cells, mouse heart tissue Positive IHC detected in: human heart tissue, mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Cyclophilin C also named as peptidyl-prolyl cis-trans isomerase C(PPIC), is expressed in several bone marrow (BM) hematopoietic progenitors and in T‐cell precursors(PMID: 33864384). CYPC/PPIC catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. Similar to other PPIases, this protein can bind immunosuppressant cyclosporin A. In addition, CYPC/PPIC is involved in many biological processes, including mitochondrial metabolism, REDOX and inflammation, as well as related diseases and conditions, such as ischemia-reperfusion injury, AIDS and cancer. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0209 Product name: Recombinant human CYPC protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 6-212 aa of BC002678 Sequence: RLLLPLVLCVGLGALVFSSGAEGFRKRGPSVTAKVFFDVRIGDKDVGRIVIGLFGKVVPKTVENFVALATGEKGYGYKGSKFHRVIKDFMIQGGDITTGDGTGGVSIYGETFPDENFKLKHYGIGWVSMANAGPDTNGSQFFITLTKPTWLDGKHVVFGKVIDGMTVVHSIELQATDGHDRPLTNCSIINSGKIDVKTPFVVEIADW Predict reactive species Full Name: peptidylprolyl isomerase C (cyclophilin C) Calculated Molecular Weight: 23 kDa Observed Molecular Weight: 23 kDa GenBank Accession Number: BC002678 Gene Symbol: PPIC/CYPC Gene ID (NCBI): 5480 RRID: AB_2169424 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P45877 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924