Proteintech, 10315-1-AP, Cathepsin H Polyclonal antibody

Size: 20ul / 150ul The Cathepsin H (10315-1-AP) by Proteintech is a Polyclonal antibody targeting Cathepsin H in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 10315-1-AP targets Cathepsin H in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A431 cells, HaCat cells, Raji cells, U-937 cells Positive IHC detected in: mouse lung tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Cathepsin H (CTSH, synonyms: CPSB, MGC1519, minichain) is a lysosomal cysteine proteinase important in the overall degradation of lysosomal proteins. It is composed of a dimer of disulfide-linked heavy and light chains, both produced from a single protein precursor. This protein, which belongs to the peptidase C1 protein family, can act both as an aminopeptidase and as an endopeptidase. Increased expression of this gene has been correlated with malignant progression of prostate tumors.Cathepsin H is a unique member of the cysteine cathepsins that acts primarily as an aminopeptidase. Like other cysteine cathepsins, it is synthesized as an inactive precursor and activated by proteolytic removal of its propeptide. In human cells, Cathepsin H exists an autocatalytic form, proceeding from an inactive 41 kDa pro-form, through a 30 kDa intermediate form, to the 28 kDa mature form (PMID: 22704610). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0361 Product name: Recombinant human CTSH protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 58-289 aa of BC002479 Sequence: FASNWRKINAHNNGNHTFKMALNQFSDMSFAEIKHKYLWSEPQNCSATKSNYLRGTGPYPPSVDWRKKGNFVSPVKNQGACGSCWTFSTTGALESAIAIATGKMLSLAEQQLVDCAQDFNNHGCQGGLPSQAFEYILYNKGIMGEDTYPYQGKDGYCKFQPGKAIGFVKDVANITIYDEEAMVEAVALYNPVSFAFEVTQDFMMYRTGIYSSTSCHKTPDKVNHAVLAVGYG Predict reactive species Full Name: cathepsin H Calculated Molecular Weight: 41 kDa, 28 kDa Observed Molecular Weight: 28, 41 kDa GenBank Accession Number: BC002479 Gene Symbol: Cathepsin H Gene ID (NCBI): 1512 RRID: AB_2087534 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P09668 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.