Iright
BRAND / VENDOR: Proteintech

Proteintech, 10319-1-AP, EIF3B Polyclonal antibody

CATALOG NUMBER: 10319-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The EIF3B (10319-1-AP) by Proteintech is a Polyclonal antibody targeting EIF3B in WB, IP, ELISA applications with reactivity to human samples 10319-1-AP targets EIF3B in WB, IF, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A375 cells Positive IP detected in: A375 cells Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information EIF3B, also named as Eukaryotic translation initiation factor 3 subunit B, is a 814 amino acid protein, which contains 1 RRM (RNA recognition motif) domain and 8 WD repeats and belongs to the eIF-3 subunit B family. EIF3B as a RNA-binding component of the eukaryotic translation initiation factor 3 (eIF-3) complex, is required for several steps in the initiation of protein synthesis. The eIF-3 complex associates with the 40S ribosome and facilitates the recruitment of eIF-1, eIF-1A, eIF-2:GTP:methionyl-tRNAi and eIF-5 to form the 43S pre-initiation complex (43S PIC). The eIF-3 complex stimulates mRNA recruitment to the 43S PIC and scanning of the mRNA for AUG recognition. The eIF-3 complex is also required for disassembly and recycling of post-termination ribosomal complexes and subsequently prevents premature joining of the 40S and 60S ribosomal subunits prior to initiation. The eIF-3 complex specifically targets and initiates translation of a subset of mRNAs involved in cell proliferation, including cell cycling, differentiation and apoptosis, and uses different modes of RNA stem-loop binding to exert either translational activation or repression. The calculated molecular weight of EIF3B is 93 kDa, but the phosphorylated EIF3B protein is about 115 kDa. Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0386 Product name: Recombinant human EIF3B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 381-562 aa of BC001173 Sequence: FSPCERYLVTFSPLMDTQDDPQAIIIWDILTGHKKRGFHCESSAHWPIFKWSHDGKFFARMTLDTLSIYETPSMGLLDKKSLKISGIKDFSWSPGGNIIAFWVPEDKDIPARVTLMQLPTRQEIRVRNLFNVVDCKLHWQKNGDYLCVKVDRTPKGTQGVVTNFEIFRMREKQVPVDVVEMK Predict reactive species Full Name: eukaryotic translation initiation factor 3, subunit B Calculated Molecular Weight: 93 kDa Observed Molecular Weight: 115 kDa GenBank Accession Number: BC001173 Gene Symbol: EIF3B Gene ID (NCBI): 8662 RRID: AB_2096732 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P55884 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924