Iright
BRAND / VENDOR: Proteintech

Proteintech, 10324-1-AP, MYL12B Polyclonal antibody

CATALOG NUMBER: 10324-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The MYL12B (10324-1-AP) by Proteintech is a Polyclonal antibody targeting MYL12B in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 10324-1-AP targets MYL12B in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse skeletal muscle tissue, mouse heart tissue, rat skeletal muscle tissues Positive IHC detected in: human colon tissue, human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information MYL12B is a regulatory subunit of myosin and plays an important role in regulation of both smooth muscle and nonmuscle cell contractile activity via its phosphorylation. There are two groups of residues on the MYL12B that are phosphorylated by distinct kinases and have contrasting effects on myosin II biophysical properties.Phosphorylation at Thr18/Ser19 essentially "activates" the myosin molecule to produce force. The second group of phosphorylated residues is at the N-terminus of the MYL12B at Ser1, Ser2 and Thr9 and causes inhibitory effect on myosin activity.(PMID: 22136066) Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, frog Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0398 Product name: Recombinant human MYL12B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 18-172 aa of BC004994 Sequence: ATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGKNPTDAYLDAMMNEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEATGTIQEDYLRELLTTMGDRFTDEEVDELYREAPIDKKGNFNYIEFTRILKHGAKDKDD Predict reactive species Full Name: myosin, light chain 12B, regulatory Calculated Molecular Weight: 20 kDa Observed Molecular Weight: 18-20 kDa GenBank Accession Number: BC004994 Gene Symbol: MYL12B Gene ID (NCBI): 103910 RRID: AB_2166830 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O14950 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924