Iright
BRAND / VENDOR: Proteintech

Proteintech, 10332-1-AP, TRAIP Polyclonal antibody

CATALOG NUMBER: 10332-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The TRAIP (10332-1-AP) by Proteintech is a Polyclonal antibody targeting TRAIP in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 10332-1-AP targets TRAIP in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: U2OS cells, A549 cells, HepG2 cells, human brain tissue, human placenta tissue, mouse placenta tissue, mouse brain tissue, rat brain tissue Positive IHC detected in: human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100 Background Information E3 ubiquitin-protein ligase TRAIP (TRAIP) is also named RING finger protein 206 (RNF206) and TRAF-interacting protein (TRIP). TRAIP, an E3 ligase containing a RING domain, has emerged as a significant contributor to maintaining genome integrity and TRAIP inhibits proliferation and migration of BLCA cells (PMID: 38123820). TRAIP helps replisomes overcome DNA interstrand crosslinks and DNA-protein crosslinks, whereas in mitosis it triggers disassembly of all replisomes that remain on chromatin (PMID: 33317933, PMID: 30842657). Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0491 Product name: Recombinant human TRAIP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-204 aa of BC000310 Sequence: MPIRALCTICSDFFDHSRDVAAIHCGHTFHLQCLIQWFETAPSRTCPQCRIQVGKRTIINKLFFDLAQEEENVLDAEFLKNELDNVRAQLSQKDKEKRDSQVIIDTLRDTLEERNATVVSLQQALGKAEMLCSTLKKQMKYLEQQQDETKQAQEEARRLRSKMKTMEQIELLLQSQRPEVEEMIRDMGVGQSAVEQLAVYCVSL Predict reactive species Full Name: TRAF interacting protein Calculated Molecular Weight: 53 kDa Observed Molecular Weight: 53 kDa GenBank Accession Number: BC000310 Gene Symbol: TRAIP Gene ID (NCBI): 10293 RRID: AB_10638481 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BWF2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924