Proteintech, 10337-1-AP, MAD2L1 Polyclonal antibody

Size: 20ul / 150ul The MAD2L1 (10337-1-AP) by Proteintech is a Polyclonal antibody targeting MAD2L1 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 10337-1-AP targets MAD2L1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: Daudi cells, rat liver tissue, HEK-293 cells, HepG2 cells, Raji cells, THP-1 cells, HeLa cells Positive IP detected in: HEK-293 cells Positive IHC detected in: mouse ovary tissue, human liver cancer tissue, human ovary tumor tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells, HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information MAD2 mitotic arrest deficient-like 1 (yeast) (MAD2L1, synonyms: MAD2, HSMAD2) is a component of the mitotic spindle assembly checkpoint that prevents the onset of anaphase until all chromosomes are properly aligned at the metaphase plate. MAD2L1 is localized to human chromosome band 5q23.3 by in situ hybridization. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0307 Product name: Recombinant human MAD2L1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 16-185 aa of BC000356 Sequence: SAEIVAEFFSFGINSILYQRGIYPSETFTRVQKYGLTLLVTTDLELIKYLNNVVEQLKDWLYKCSVQKLVVVISNIESGEVLERWQFDIECDKTAKDDSAPREKSQKAIQDEIRSVIRQITATVTFLPLLEVSCSFDLLIYTDKDLVVPEKWEESGPQFITNSEEVRLRS Predict reactive species Full Name: MAD2 mitotic arrest deficient-like 1 (yeast) Calculated Molecular Weight: 24 kDa Observed Molecular Weight: 25-30 kDa GenBank Accession Number: BC000356 Gene Symbol: MAD2L1 Gene ID (NCBI): 4085 RRID: AB_2139365 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q13257 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.